PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S02261.70
Common NameJCGZ_22391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 339aa    MW: 38678.6 Da    PI: 8.6975
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S02261.70genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.83.3e-26216265352
         RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                    ++i ledl kyF lpi++A+++L+v+lTvLK++CR++GI+RWPhRkiksl
  Jcr4S02261.70 216 ARIALEDLVKYFGLPIAEASRNLKVGLTVLKKKCREFGIPRWPHRKIKSL 265
                    689*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.247202285IPR003035RWP-RK domain
PfamPF020426.3E-21218265IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEDSCQDISL TALLVFQNTI NTELIRCLHV YRLEDGKEKE VQREFLFSVD NPYIEIAANP  60
LLMLGRFKVM ELFEGQVIGL WQCMFAFHAD HPPHLSHIPS LLSISRNPKL KSIPTLANDL  120
QLIFKLSSRT ADGESLQFLS KGKCERARGD CCQSKKSLPV LDQDLNCLPY SIATPELSND  180
QQTEPSAPVD CNAAHAEESC SSVAKKKKRA ATEDIARIAL EDLVKYFGLP IAEASRNLKV  240
GLTVLKKKCR EFGIPRWPHR KIKSLDSLIH NLQEEAERQK QENENAAMAV AKRQKMLEKE  300
KETIERKPFI EIQSETKRFR QDVFKRRHRA RALRNQGSP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012065451.10.0PREDICTED: rab proteins geranylgeranyltransferase component A
SwissprotO817914e-97RKD5_ARATH; Protein RKD5
TrEMBLA0A067LHU70.0A0A067LHU7_JATCU; Uncharacterized protein
STRINGPOPTR_0005s10400.11e-131(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96463042
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.17e-91RWP-RK domain-containing protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]